PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_2744_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 200aa    MW: 23215.8 Da    PI: 8.9166
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_2744_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.7e-173075148
                                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                        rg++T+ E+ l ++++ ++G++ W++Iar+++ gRt++++k++w++++
  cra_locus_2744_iso_2_len_905_ver_3 30 RGKMTPHEERLVLELHSKWGNR-WSRIARKLP-GRTDNEIKNYWRTHM 75
                                        89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-41736IPR009057Homeodomain-like
SuperFamilySSF466895.49E-181781IPR009057Homeodomain-like
PROSITE profilePS5129426.4642579IPR017930Myb domain
SMARTSM007171.8E-162977IPR001005SANT/Myb domain
PfamPF002495.4E-153074IPR001005SANT/Myb domain
CDDcd001673.11E-113275No hitNo description
Gene3DG3DSA:1.10.10.602.8E-203776IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
FIAKVSGLKV AGDTNNRLRW VNYLHPGLKR GKMTPHEERL VLELHSKWGN RWSRIARKLP  60
GRTDNEIKNY WRTHMRKKAQ DQRKKASNNN NNLSPTSSSS LSNCSSSSSN SQGNNSPTVD  120
SVLITETKDR SFYDTGGFEF DQIEAEKKKN MSNEEETEEL ERGPKFYSMD EIWKDIEMSE  180
DDAIKPVNYD YQKMDSPQMW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-14177943105MYB PROTO-ONCOGENE PROTEIN
1h88_C6e-14177997159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-14177997159MYB PROTO-ONCOGENE PROTEIN
1h8a_C4e-14177966128MYB TRANSFORMING PROTEIN
1mse_C3e-14177943105C-Myb DNA-Binding Domain
1msf_C3e-14177943105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010651059.12e-63PREDICTED: transcription factor MYB59
SwissprotQ9LX822e-52MYB48_ARATH; Transcription factor MYB48
TrEMBLA0A068UKJ25e-63A0A068UKJ2_COFCA; Uncharacterized protein
STRINGVIT_06s0004g04140.t012e-60(Vitis vinifera)